| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
| Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries) |
| Domain d1tuib3: 1tui B:9-212 [32129] Other proteins in same PDB: d1tuia1, d1tuia2, d1tuib1, d1tuib2, d1tuic1, d1tuic2 complexed with gdp, mg |
PDB Entry: 1tui (more details), 2.7 Å
SCOPe Domain Sequences for d1tuib3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuib3 c.37.1.8 (B:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]}
kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
krgenewvdkiwelldaideyipt
Timeline for d1tuib3: