Lineage for d1tuib3 (1tui B:9-212)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1163949Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 1163971Species Thermus aquaticus [TaxId:271] [52628] (5 PDB entries)
  8. 1163978Domain d1tuib3: 1tui B:9-212 [32129]
    Other proteins in same PDB: d1tuia1, d1tuia2, d1tuib1, d1tuib2, d1tuic1, d1tuic2
    complexed with gdp, mg

Details for d1tuib3

PDB Entry: 1tui (more details), 2.7 Å

PDB Description: intact elongation factor tu in complex with gdp
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d1tuib3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuib3 c.37.1.8 (B:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]}
kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleemhknpkt
krgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d1tuib3:

Click to download the PDB-style file with coordinates for d1tuib3.
(The format of our PDB-style files is described here.)

Timeline for d1tuib3: