Lineage for d1as2a2 (1as2 A:32-60,A:182-346)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696366Protein Transducin (alpha subunit) [52623] (3 species)
    common fold is interrupted with an all-alpha domain
  7. 696393Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (26 PDB entries)
  8. 696409Domain d1as2a2: 1as2 A:32-60,A:182-346 [32110]
    Other proteins in same PDB: d1as2a1
    complexed with gdp, po4; mutant

Details for d1as2a2

PDB Entry: 1as2 (more details), 2.8 Å

PDB Description: gdp+pi bound g42v gia1
PDB Compounds: (A:) gia1

SCOP Domain Sequences for d1as2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1as2a2 c.37.1.8 (A:32-60,A:182-346) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}
revkllllgavesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviikn

SCOP Domain Coordinates for d1as2a2:

Click to download the PDB-style file with coordinates for d1as2a2.
(The format of our PDB-style files is described here.)

Timeline for d1as2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1as2a1