| Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
| Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) ![]() |
| Family c.37.1.8: G proteins [52592] (20 proteins) |
| Protein Transducin (alpha subunit) [52623] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries) |
| Domain d1fqkc2: 1fqk C:29-60,C:182-345 [32104] Other proteins in same PDB: d1fqka1, d1fqkb_, d1fqkc1, d1fqkd_ |
PDB Entry: 1fqk (more details), 2.3 Å
SCOP Domain Sequences for d1fqkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqkc2 c.37.1.8 (C:29-60,C:182-345) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
tvkllllgagesgkstivkqmkiihqdgysleXetqfsfkdlnfrmfdvggqrserkkwi
hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
lfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqnv
kfvfdavtdiiikenlk
Timeline for d1fqkc2:
View in 3DDomains from other chains: (mouse over for more information) d1fqka1, d1fqka2, d1fqkb_, d1fqkd_ |