Lineage for d1fqka2 (1fqk A:28-60,A:182-345)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69860Protein Transducin (alpha subunit) [52623] (2 species)
  7. 69878Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries)
  8. 69897Domain d1fqka2: 1fqk A:28-60,A:182-345 [32103]
    Other proteins in same PDB: d1fqka1, d1fqkb_, d1fqkc1, d1fqkd_

Details for d1fqka2

PDB Entry: 1fqk (more details), 2.3 Å

PDB Description: crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)- (alf4-)-(mg2+)]

SCOP Domain Sequences for d1fqka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqka2 c.37.1.8 (A:28-60,A:182-345) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
rtvkllllgagesgkstivkqmkiihqdgysleXetqfsfkdlnfrmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqn
vkfvfdavtdiiikenlk

SCOP Domain Coordinates for d1fqka2:

Click to download the PDB-style file with coordinates for d1fqka2.
(The format of our PDB-style files is described here.)

Timeline for d1fqka2: