Lineage for d1fqjd2 (1fqj D:28-60,D:182-342)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363685Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1363734Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
    Uniprot P10824
  8. 1363758Domain d1fqjd2: 1fqj D:28-60,D:182-342 [32099]
    Other proteins in same PDB: d1fqja1, d1fqjb_, d1fqjc_, d1fqjd1, d1fqje_
    complexed with alf, gdp, mg

Details for d1fqjd2

PDB Entry: 1fqj (more details), 2.02 Å

PDB Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
PDB Compounds: (D:) chimera of guanine nucleotide-binding protein g(t), alpha-1 subunit and guanine nucleotide-binding protein g(I), alpha-1 subunit

SCOPe Domain Sequences for d1fqjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqjd2 c.37.1.8 (D:28-60,D:182-342) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtvkllllgagesgkstivkqmkiihqdgysleXetqfsfkdlnfrmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeagnyikvqflelnmrrdvkeiyshmtcatdtqn
vkfvfdavtdiiike

SCOPe Domain Coordinates for d1fqjd2:

Click to download the PDB-style file with coordinates for d1fqjd2.
(The format of our PDB-style files is described here.)

Timeline for d1fqjd2: