Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) |
Family c.37.1.8: G proteins [52592] (20 proteins) |
Protein Transducin (alpha subunit) [52623] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries) |
Domain d1cjvc2: 1cjv C:39-65,C:202-388 [32091] Other proteins in same PDB: d1cjva_, d1cjvb_, d1cjvc1 |
PDB Entry: 1cjv (more details), 3 Å
SCOP Domain Sequences for d1cjvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjvc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus)} athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg dgrhycyphftcavdtenirrvfndcrdiiqrmhl
Timeline for d1cjvc2: