Lineage for d1cjvc2 (1cjv C:39-65,C:202-388)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23317Protein Transducin (alpha subunit) [52623] (2 species)
  7. 23318Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)
  8. 23334Domain d1cjvc2: 1cjv C:39-65,C:202-388 [32091]
    Other proteins in same PDB: d1cjva_, d1cjvb_, d1cjvc1

Details for d1cjvc2

PDB Entry: 1cjv (more details), 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn

SCOP Domain Sequences for d1cjvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjvc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus)}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

SCOP Domain Coordinates for d1cjvc2:

Click to download the PDB-style file with coordinates for d1cjvc2.
(The format of our PDB-style files is described here.)

Timeline for d1cjvc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cjvc1