SCOPe 2.03: Domain d1aztb2: 1azt B:35-69,B:202-391

Lineage for d1aztb2 (1azt B:35-69,B:202-391)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
   Uniprot P04896 39-388

8. Domain d1aztb2: 1azt B:35-69,B:202-391 [32085]
   Other proteins in same PDB: d1azta1, d1aztb1
   complexed with gsp, mg, po4

Details for d1aztb2

PDB Entry: 1azt, 2.3 Å

PDB Description: gs-alpha complexed with gtp-gamma-s

PDB Compounds: (B:) gs-alpha

SCOPe Domain Sequences for d1aztb2:

Sequence; same for both SEQRES and ATOM records:

>d1aztb2 c.37.1.8 (B:35-69,B:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
qvyrathrllllgagesgkstivkqmrilhvngfnXvltsgifetkfqvdkvnfhmfdvg
gqrderrkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrti
svilflnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdef
lristasgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqy

Timeline for d1aztb2:

• d1aztb2 first appeared (with stable ids) in SCOP 1.55
  
• d1aztb2 appears in SCOPe 2.02
  
• d1aztb2 appears in SCOPe 2.04
  
• d1aztb2 appears in the current release, SCOPe 2.08