Lineage for d1tndc2 (1tnd C:27-56,C:178-342)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69860Protein Transducin (alpha subunit) [52623] (2 species)
  7. 69861Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)
  8. 69868Domain d1tndc2: 1tnd C:27-56,C:178-342 [32083]
    Other proteins in same PDB: d1tnda1, d1tndb1, d1tndc1

Details for d1tndc2

PDB Entry: 1tnd (more details), 2.2 Å

PDB Description: the 2.2 angstroms crystal structure of transducin-alpha complexed with gtp gamma s

SCOP Domain Sequences for d1tndc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tndc2 c.37.1.8 (C:27-56,C:178-342) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiike

SCOP Domain Coordinates for d1tndc2:

Click to download the PDB-style file with coordinates for d1tndc2.
(The format of our PDB-style files is described here.)

Timeline for d1tndc2: