|  | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) | 
|  | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes | 
|  | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)  division into families based on beta-sheet topologies | 
|  | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest | 
|  | Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain | 
|  | Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries) Uniprot P04896 39-388 | 
|  | Domain d1tadb2: 1tad B:27-56,B:178-342 [32078] Other proteins in same PDB: d1tada1, d1tadb1, d1tadc1 complexed with alf, ca, cac, gdp | 
PDB Entry: 1tad (more details), 1.7 Å
SCOPe Domain Sequences for d1tadb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tadb2 c.37.1.8 (B:27-56,B:178-342) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiike
Timeline for d1tadb2:
|  View in 3D Domains from other chains: (mouse over for more information) d1tada1, d1tada2, d1tadc1, d1tadc2 |