SCOP 1.67: Domain d1e0aa_: 1e0a A:

Lineage for d1e0aa_ (1e0a A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (16 PDB entries)

8. Domain d1e0aa_: 1e0a A: [32074]
   Other proteins in same PDB: d1e0ab_
   complexed with gnp, mg; mutant

Details for d1e0aa_

PDB Entry: 1e0a

PDB Description: cdc42 complexed with the gtpase binding domain of p21 activated kinase

SCOP Domain Sequences for d1e0aa_:

Sequence; same for both SEQRES and ATOM records:

>d1e0aa_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkk

Timeline for d1e0aa_:

• d1e0aa_ first appeared (with stable ids) in SCOP 1.55
  
• d1e0aa_ appears in SCOP 1.65
  
• d1e0aa_ appears in SCOP 1.69
  
• d1e0aa_ appears in the current release, SCOPe 2.08