Lineage for d5p13a_ (5p13 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2801552Protein Endothiapepsin [50647] (1 species)
  7. 2801553Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (538 PDB entries)
  8. 2801859Domain d5p13a_: 5p13 A: [320683]
    automated match to d1oewa_

Details for d5p13a_

PDB Entry: 5p13 (more details), 1.4 Å

PDB Description: automated refinement of diffraction data obtained from an endothiapepsin crystal treated with fragment 86
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5p13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5p13a_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5p13a_:

Click to download the PDB-style file with coordinates for d5p13a_.
(The format of our PDB-style files is described here.)

Timeline for d5p13a_: