Lineage for d1doaa_ (1doa A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein CDC42 [52619] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52620] (14 PDB entries) 
Domain d1doaa_: 1doa A: [32065]
Other proteins in same PDB: d1doab_
Details for d1doaa_
PDB Entry: 1doa (more details), 2.6 Å
PDB Description: Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi
SCOP Domain Sequences for d1doaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1doaa_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens)}
gshmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfd
tagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqi
dlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
eppepkksrrc
SCOP Domain Coordinates for d1doaa_:
Click to download the PDB-style file with coordinates for d1doaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1doaa_:
- d1doaa_ first appeared (with stable ids) in SCOP 1.55
- d1doaa_ appears in SCOP 1.59
- d1doaa_ appears in SCOP 1.63
- d1doaa_ appears in the current release, SCOPe 2.08, called d1doaa1
View in 3D
