Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190296] (11 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [226264] (2 PDB entries) |
Domain d5kwsa_: 5kws A: [320549] automated match to d1gcaa_ complexed with acy, bgc, ca, edo, gol, na |
PDB Entry: 5kws (more details), 1.32 Å
SCOPe Domain Sequences for d5kwsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kwsa_ c.93.1.1 (A:) automated matches {Yersinia pestis [TaxId: 214092]} aetrigvtiykyddnfmsvvrkaiekdakaspeitllmndsqndqskqndqidvllakgv kalainlvdpaaapvvidkarsndipivfynkepsrkaldsydkayyvgtdskesgviqg eliakhwqanpewdlnkdgkiqfvllkgepghpdaearttyviktlnekglptqqlqldt amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnktsvpvfgvdalpe alalvksgqmagtvlndannqakatfdlaknlaagkpaaegttwkienkivripyvgvdk dnlaeft
Timeline for d5kwsa_: