Lineage for d5kwsa_ (5kws A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913163Protein automated matches [190296] (11 species)
    not a true protein
  7. 2913226Species Yersinia pestis [TaxId:214092] [226264] (2 PDB entries)
  8. 2913227Domain d5kwsa_: 5kws A: [320549]
    automated match to d1gcaa_
    complexed with acy, bgc, ca, edo, gol, na

Details for d5kwsa_

PDB Entry: 5kws (more details), 1.32 Å

PDB Description: crystal structure of galactose binding protein from yersinia pestis in the complex with beta d glucose
PDB Compounds: (A:) galactose-binding protein

SCOPe Domain Sequences for d5kwsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kwsa_ c.93.1.1 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
aetrigvtiykyddnfmsvvrkaiekdakaspeitllmndsqndqskqndqidvllakgv
kalainlvdpaaapvvidkarsndipivfynkepsrkaldsydkayyvgtdskesgviqg
eliakhwqanpewdlnkdgkiqfvllkgepghpdaearttyviktlnekglptqqlqldt
amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnktsvpvfgvdalpe
alalvksgqmagtvlndannqakatfdlaknlaagkpaaegttwkienkivripyvgvdk
dnlaeft

SCOPe Domain Coordinates for d5kwsa_:

Click to download the PDB-style file with coordinates for d5kwsa_.
(The format of our PDB-style files is described here.)

Timeline for d5kwsa_: