SCOPe 2.06: Domain d5kdog_: 5kdo G:

Lineage for d5kdog_ (5kdo G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)

6. Protein automated matches [320489] (1 species)
   not a true protein

7. Species Bos taurus [TaxId:9913] [320490] (1 PDB entry)

8. Domain d5kdog_: 5kdo G: [320491]
   Other proteins in same PDB: d5kdob_
   automated match to d2trcg_
   complexed with gdp

Details for d5kdog_

PDB Entry: 5kdo, 1.9 Å

PDB Description: heterotrimeric complex of the 4 alanine insertion variant of the gi alpha1 subunit and the gbeta1-ggamma1

PDB Compounds: (G:) Guanine nucleotide-binding protein G(T) subunit gamma-T1

SCOPe Domain Sequences for d5kdog_:

Sequence; same for both SEQRES and ATOM records:

>d5kdog_ a.137.3.1 (G:) automated matches {Bos taurus [TaxId: 9913]}
tekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfk

Timeline for d5kdog_:

• d5kdog_ is new in SCOPe 2.06-stable
  
• d5kdog_ appears in SCOPe 2.07
  
• d5kdog_ appears in the current release, SCOPe 2.08