Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
Protein automated matches [320489] (1 species) not a true protein |
Species Bos taurus [TaxId:9913] [320490] (1 PDB entry) |
Domain d5kdog_: 5kdo G: [320491] Other proteins in same PDB: d5kdob_ automated match to d2trcg_ complexed with gdp |
PDB Entry: 5kdo (more details), 1.9 Å
SCOPe Domain Sequences for d5kdog_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kdog_ a.137.3.1 (G:) automated matches {Bos taurus [TaxId: 9913]} tekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfk
Timeline for d5kdog_: