Lineage for d5hywd_ (5hyw D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348494Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2348495Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2348542Family a.157.1.0: automated matches [227205] (1 protein)
    not a true family
  6. 2348543Protein automated matches [226937] (1 species)
    not a true protein
  7. 2348544Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries)
  8. 2348557Domain d5hywd_: 5hyw D: [320357]
    automated match to d3c6na_

Details for d5hywd_

PDB Entry: 5hyw (more details), 3.01 Å

PDB Description: the crystal structure of the d3-ask1 complex
PDB Compounds: (D:) SKP1-like protein 1A

SCOPe Domain Sequences for d5hywd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hywd_ a.157.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeee
vrrenqwafe

SCOPe Domain Coordinates for d5hywd_:

Click to download the PDB-style file with coordinates for d5hywd_.
(The format of our PDB-style files is described here.)

Timeline for d5hywd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5hywb_