SCOPe 2.07: Domain d5hywd_: 5hyw D:

Lineage for d5hywd_ (5hyw D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.0: automated matches [227205] (1 protein)
   not a true family

6. Protein automated matches [226937] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries)

8. Domain d5hywd_: 5hyw D: [320357]
   automated match to d3c6na_

Details for d5hywd_

PDB Entry: 5hyw, 3.01 Å

PDB Description: the crystal structure of the d3-ask1 complex

PDB Compounds: (D:) SKP1-like protein 1A

SCOPe Domain Sequences for d5hywd_:

Sequence; same for both SEQRES and ATOM records:

>d5hywd_ a.157.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mkidqatlfelilaanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeee
vrrenqwafe

Timeline for d5hywd_:

• d5hywd_ first appeared in SCOPe 2.06
  
• d5hywd_ appears in the current release, SCOPe 2.08