Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.0: automated matches [238448] (1 protein) not a true family |
Protein automated matches [238450] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [238452] (7 PDB entries) |
Domain d5b33g_: 5b33 G: [320320] Other proteins in same PDB: d5b33a_, d5b33b_, d5b33d_, d5b33e_, d5b33f_, d5b33h_ automated match to d1id3c_ protein/DNA complex |
PDB Entry: 5b33 (more details), 2.93 Å
SCOPe Domain Sequences for d5b33g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b33g_ a.22.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskdl kvkritprhlqlairgdeeldslikatiagggviphihksligk
Timeline for d5b33g_: