Lineage for d3rapr_ (3rap R:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 394080Protein Rap2a [52599] (1 species)
  7. 394081Species Human (Homo sapiens) [TaxId:9606] [52600] (3 PDB entries)
  8. 394083Domain d3rapr_: 3rap R: [32015]

Details for d3rapr_

PDB Entry: 3rap (more details), 2.2 Å

PDB Description: the small g protein rap2 in a non catalytic complex with gtp

SCOP Domain Sequences for d3rapr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rapr_ c.37.1.8 (R:) Rap2a {Human (Homo sapiens)}
mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag
teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl
eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya

SCOP Domain Coordinates for d3rapr_:

Click to download the PDB-style file with coordinates for d3rapr_.
(The format of our PDB-style files is described here.)

Timeline for d3rapr_: