SCOPe 2.07: Domain d5fxfa1: 5fxf A:2-238

Lineage for d5fxfa1 (5fxf A:2-238)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.0: automated matches [191624] (1 protein)
   not a true family

6. Protein automated matches [191143] (12 species)
   not a true protein

7. Species Rhodococcus jostii [TaxId:101510] [319925] (4 PDB entries)

8. Domain d5fxfa1: 5fxf A:2-238 [320044]
   Other proteins in same PDB: d5fxfa2, d5fxfb2
   automated match to d1e0ya2
   complexed with bez, fad, gol

Details for d5fxfa1

PDB Entry: 5fxf, 1.9 Å

PDB Description: crystal structure of eugenol oxidase in complex with benzoate

PDB Compounds: (A:) eugenol oxidase

SCOPe Domain Sequences for d5fxfa1:

Sequence; same for both SEQRES and ATOM records:

>d5fxfa1 d.145.1.0 (A:2-238) automated matches {Rhodococcus jostii [TaxId: 101510]}
trtlppgvsderfdaalqrfrdvvgdkwvlstadeleafrdpypvgaaeanlpsavvspe
steqvqdivrianeygiplspvstgknngyggaaprlsgsvivktgermnrilevnekyg
yallepgvtyfdlyeylqshdsglmldcpdlgwgsvvgntldrgvgytpygdhfmwqtgl
evvlpqgevmrtgmgalpgsdawqlfpygfgpfpdgmftqsnlgivtkmgialmqrp

Timeline for d5fxfa1:

• d5fxfa1 first appeared in SCOPe 2.06
  
• d5fxfa1 appears in the current release, SCOPe 2.08