SCOPe 2.04: Domain d521pa_: 521p A:

Lineage for d521pa_ (521p A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (104 PDB entries)
   Uniprot Q6P716

8. Domain d521pa_: 521p A: [31992]
   complexed with gtp, mg; mutant

Details for d521pa_

PDB Entry: 521p, 2.6 Å

PDB Description: three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules

PDB Compounds: (A:) h-ras p21 protein

SCOPe Domain Sequences for d521pa_:

Sequence; same for both SEQRES and ATOM records:

>d521pa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildttg
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d521pa_:

• d521pa_ first appeared (with stable ids) in SCOP 1.55, called d521p__
  
• d521pa_ appears in SCOPe 2.03
  
• d521pa_ appears in SCOPe 2.05
  
• d521pa_ appears in the current release, SCOPe 2.08