| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein cH-p21 Ras protein [52593] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52594] (104 PDB entries) Uniprot Q6P716 |
| Domain d621pa_: 621p A: [31988] complexed with gnp, mg; mutant |
PDB Entry: 621p (more details), 2.4 Å
SCOPe Domain Sequences for d621pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d621pa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d621pa_: