SCOP 1.73: Domain d2q21a_: 2q21 A:

Lineage for d2q21a_ (2q21 A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (52 PDB entries)

8. Domain d2q21a_: 2q21 A: [31986]
   complexed with gdp, mg; mutant

Details for d2q21a_

PDB Entry: 2q21, 2.2 Å

PDB Description: crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp

PDB Compounds: (A:) c-h-ras p21 protein catalytic domain

SCOP Domain Sequences for d2q21a_:

Sequence; same for both SEQRES and ATOM records:

>d2q21a_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqhklrkl

Timeline for d2q21a_:

• d2q21a_ first appeared (with stable ids) in SCOP 1.55, called d2q21__
  
• d2q21a_ was called d2q21__ in SCOP 1.71
  
• d2q21a_ appears in SCOP 1.75
  
• d2q21a_ appears in the current release, SCOPe 2.08