Lineage for d5la6a1 (5la6 A:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863314Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)
  8. 2863575Domain d5la6a1: 5la6 A:1-245 [319833]
    Other proteins in same PDB: d5la6a2, d5la6b2, d5la6c2, d5la6d2, d5la6e_, d5la6f1, d5la6f2, d5la6f3
    automated match to d4ihja1
    complexed with acp, ca, gdp, gtp, mg, x3h

Details for d5la6a1

PDB Entry: 5la6 (more details), 2.1 Å

PDB Description: tubulin-pironetin complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5la6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5la6a1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5la6a1:

Click to download the PDB-style file with coordinates for d5la6a1.
(The format of our PDB-style files is described here.)

Timeline for d5la6a1: