![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
![]() | Family a.137.10.1: Stathmin [101495] (2 proteins) |
![]() | Protein Stathmin 4 [101496] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
![]() | Domain d5la6e_: 5la6 E: [319876] Other proteins in same PDB: d5la6a1, d5la6a2, d5la6b1, d5la6b2, d5la6c1, d5la6c2, d5la6d1, d5la6d2, d5la6f1, d5la6f2, d5la6f3 automated match to d4i55e_ complexed with acp, ca, gdp, gtp, mg, x3h |
PDB Entry: 5la6 (more details), 2.1 Å
SCOPe Domain Sequences for d5la6e_:
Sequence, based on SEQRES records: (download)
>d5la6e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkeea
>d5la6e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk eea
Timeline for d5la6e_: