SCOPe 2.07: Domain d5cdja_: 5cdj A:

Lineage for d5cdja_ (5cdj A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.0: automated matches [227259] (1 protein)
   not a true family

6. Protein automated matches [227050] (2 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [319461] (2 PDB entries)

8. Domain d5cdja_: 5cdj A: [319501]
   automated match to d3vz7a_

Details for d5cdja_

PDB Entry: 5cdj, 1.75 Å

PDB Description: apical domain of chloroplast chaperonin 60a

PDB Compounds: (A:) RuBisCO large subunit-binding protein subunit alpha, chloroplastic

SCOPe Domain Sequences for d5cdja_:

Sequence; same for both SEQRES and ATOM records:

>d5cdja_ c.8.5.0 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gmeidrgyispqfvtnqerllveydncrvlvtdqkidairdiipileqvtrlnaplliia
edvsgealatlvvnklrgvlnvcaikapgfgerrksllqdiaivtgaefiakdlgmkveq
avveqlgvarkvtvanntttliadaaskdeiemriaqlkkelaetdsvydteklseriak
ls

Timeline for d5cdja_:

• d5cdja_ first appeared in SCOPe 2.06
  
• d5cdja_ appears in the current release, SCOPe 2.08