Lineage for d5cfga_ (5cfg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988140Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2988163Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 2988164Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries)
  8. 2988178Domain d5cfga_: 5cfg A: [319395]
    automated match to d1e9na_
    complexed with mg

Details for d5cfga_

PDB Entry: 5cfg (more details), 1.8 Å

PDB Description: c2 crystal form of ape1 with mg2+
PDB Compounds: (A:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d5cfga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cfga_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
yfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d5cfga_:

Click to download the PDB-style file with coordinates for d5cfga_.
(The format of our PDB-style files is described here.)

Timeline for d5cfga_: