PDB entry 5cfg

View 5cfg on RCSB PDB site
Description: C2 crystal form of APE1 with Mg2+
Class: lyase
Keywords: AP endonuclease, LYASE
Deposited on 2015-07-08, released 2016-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: APEX1, APE, APE1, APEX, APX, HAP1, REF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cfga_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5cfgA (A:)
lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
yfllshsllpalcdskirskalgsdhcpitlylal