Lineage for d5kl9d_ (5kl9 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550606Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2550713Protein automated matches [190155] (3 species)
    not a true protein
  7. 2550714Species Escherichia coli [TaxId:83334] [319369] (3 PDB entries)
  8. 2550726Domain d5kl9d_: 5kl9 D: [319388]
    automated match to d1s5uc_
    complexed with coa, gol, so4

Details for d5kl9d_

PDB Entry: 5kl9 (more details), 2.22 Å

PDB Description: crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa
PDB Compounds: (D:) Acyl-CoA thioester hydrolase ybgC

SCOPe Domain Sequences for d5kl9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kl9d_ d.38.1.1 (D:) automated matches {Escherichia coli [TaxId: 83334]}
tlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkmt
veyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpra
lpksivaef

SCOPe Domain Coordinates for d5kl9d_:

Click to download the PDB-style file with coordinates for d5kl9d_.
(The format of our PDB-style files is described here.)

Timeline for d5kl9d_: