Lineage for d5i3mb_ (5i3m B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205924Protein automated matches [190182] (1 species)
    not a true protein
  7. 2205925Species Human (Homo sapiens) [TaxId:9606] [186920] (47 PDB entries)
  8. 2205986Domain d5i3mb_: 5i3m B: [319286]
    automated match to d4i03a_
    complexed with 67f, ca, dio, dms, edo, pgo, zn

Details for d5i3mb_

PDB Entry: 5i3m (more details), 2.17 Å

PDB Description: crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated thiourea-linked carboxylate zinc-chelator water-soluble inhibitor (dc31).
PDB Compounds: (B:) Macrophage metalloelastase

SCOPe Domain Sequences for d5i3mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i3mb_ d.92.1.11 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfarg
ahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhqighslgl
ghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d5i3mb_:

Click to download the PDB-style file with coordinates for d5i3mb_.
(The format of our PDB-style files is described here.)

Timeline for d5i3mb_: