SCOPe 2.07: Domain d5a4ve1: 5a4v E:2-86

Lineage for d5a4ve1 (5a4v E:2-86)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
Protein automated matches [227019] (4 species)
not a true protein
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318873] (4 PDB entries)
Domain d5a4ve1: 5a4v E:2-86 [319061]
Other proteins in same PDB: d5a4va2, d5a4vb2, d5a4vc2, d5a4vd2, d5a4ve2, d5a4vf2
automated match to d1gnwa2
complexed with act, que

Details for d5a4ve1

PDB Entry: 5a4v (more details), 2.38 Å

PDB Description: atgstf2 from arabidopsis thaliana in complex with quercetin

PDB Compounds: (E:) glutathione s-transferase f2

SCOPe Domain Sequences for d5a4ve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4ve1 c.47.1.5 (E:2-86) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
agikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedg
dlklfesraitqyiahryenqgtnl

SCOPe Domain Coordinates for d5a4ve1:

Click to download the PDB-style file with coordinates for d5a4ve1.
(The format of our PDB-style files is described here.)

Timeline for d5a4ve1: