Lineage for d5a4kc_ (5a4k C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2115683Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2115876Protein automated matches [190235] (2 species)
    not a true protein
  7. 2115877Species Human (Homo sapiens) [TaxId:9606] [187003] (7 PDB entries)
  8. 2115888Domain d5a4kc_: 5a4k C: [318872]
    automated match to d1d4aa_
    complexed with btb, fad

Details for d5a4kc_

PDB Entry: 5a4k (more details), 2.09 Å

PDB Description: crystal structure of the r139w variant of human nad(p)h:quinone oxidoreductase
PDB Compounds: (C:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d5a4kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4kc_ c.23.5.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
gefaytyaamydkgpfwskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
vqdeeknkkfglsvghhlgksiptdnqikar

SCOPe Domain Coordinates for d5a4kc_:

Click to download the PDB-style file with coordinates for d5a4kc_.
(The format of our PDB-style files is described here.)

Timeline for d5a4kc_: