Lineage for d5jbxa_ (5jbx A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113514Species Myxococcus xanthus [TaxId:246197] [318813] (2 PDB entries)
  8. 2113515Domain d5jbxa_: 5jbx A: [318854]
    Other proteins in same PDB: d5jbxb2, d5jbxc2
    automated match to d4f47a_
    complexed with coa, mli

Details for d5jbxa_

PDB Entry: 5jbx (more details), 1.1 Å

PDB Description: crystal structure of liuc in complex with coenzyme a and malonic acid
PDB Compounds: (A:) 3-hydroxybutyryl-CoA dehydratase

SCOPe Domain Sequences for d5jbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jbxa_ c.14.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}
mpefkvdargpieiwtidgesrrnaisramlkelgelvtrvsssrdvravvitgagdkaf
cagadlkeratmaedevrafldglrrtfraieksdcvfiaaingaalgggtelalacdlr
vaapaaelgltevklgiipggggtqrlarlvgpgrakdliltarrinaaeafsvglanrl
apeghllavayglaesvvenapiavatakhaidegtglelddalalelrkyeeilktedr
leglrafaekrapvykgr

SCOPe Domain Coordinates for d5jbxa_:

Click to download the PDB-style file with coordinates for d5jbxa_.
(The format of our PDB-style files is described here.)

Timeline for d5jbxa_: