SCOPe 2.08: Domain d5a36a2: 5a36 A:147-257

Lineage for d5a36a2 (5a36 A:147-257)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d5a36a2: 5a36 A:147-257 [318679]
   automated match to d2wa5a2
   mutant

Details for d5a36a2

PDB Entry: 5a36, 2 Å

PDB Description: mutations in the calponin homology domain of alpha-actinin- 2 affect actin binding and incorporation in muscle.

PDB Compounds: (A:) alpha-actinin-2

SCOPe Domain Sequences for d5a36a2:

Sequence; same for both SEQRES and ATOM records:

>d5a36a2 a.40.1.0 (A:147-257) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveetsakeglllwcqrktapyrnvniqnfhtswkdglglcalihrhrpdlidysklnkd
dpigninlameiaekhldipkmldaedivntpkpderaimtyvscfyhafa

Timeline for d5a36a2:

• d5a36a2 first appeared in SCOPe 2.06
  
• d5a36a2 appears in SCOPe 2.07