Lineage for d5b2ha1 (5b2h A:3-148)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401664Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2401831Protein automated matches [190608] (4 species)
    not a true protein
  7. 2401832Species Clostridium botulinum [TaxId:1491] [230685] (7 PDB entries)
  8. 2401857Domain d5b2ha1: 5b2h A:3-148 [318579]
    automated match to d2e4ma1
    complexed with pge

Details for d5b2ha1

PDB Entry: 5b2h (more details), 2.2 Å

PDB Description: crystal structure of ha33 from clostridium botulinum serotype c strain yoichi
PDB Compounds: (A:) ha-33

SCOPe Domain Sequences for d5b2ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b2ha1 b.42.2.1 (A:3-148) automated matches {Clostridium botulinum [TaxId: 1491]}
qtnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykik
vmdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqynidd
tlmvstqtsssnqffkfsnciyesfn

SCOPe Domain Coordinates for d5b2ha1:

Click to download the PDB-style file with coordinates for d5b2ha1.
(The format of our PDB-style files is described here.)

Timeline for d5b2ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5b2ha2