Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein UMP/CMP kinase [52550] (2 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [52551] (6 PDB entries) |
Domain d2ukda_: 2ukd A: [31852] complexed with adp, c5p, mg |
PDB Entry: 2ukd (more details), 2.2 Å
SCOPe Domain Sequences for d2ukda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ukda_ c.37.1.1 (A:) UMP/CMP kinase {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} skpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmiknge ivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpeev mtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnevyn dvenlfksmgf
Timeline for d2ukda_: