SCOP 1.71: Domain d3ukd__: 3ukd -

Lineage for d3ukd__ (3ukd -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein UMP/CMP kinase [52550] (2 species)

7. Species Dictyostelium discoideum [TaxId:44689] [52551] (6 PDB entries)

8. Domain d3ukd__: 3ukd - [31849]
   complexed with adp, af3, c5p, mg

Details for d3ukd__

PDB Entry: 3ukd, 1.9 Å

PDB Description: ump/cmp kinase from slime mold complexed with adp, cmp, and alf3

SCOP Domain Sequences for d3ukd__:

Sequence; same for both SEQRES and ATOM records:

>d3ukd__ c.37.1.1 (-) UMP/CMP kinase {Dictyostelium discoideum}
skpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmiknge
ivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpeev
mtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnevyn
dvenlfksmgf

Timeline for d3ukd__:

• d3ukd__ first appeared (with stable ids) in SCOP 1.55
  
• d3ukd__ appears in SCOP 1.69
  
• d3ukd__ is called d3ukda_ in SCOP 1.73
  
• d3ukd__ appears in the current release, SCOPe 2.08, called d3ukda_