Lineage for d3ukd__ (3ukd -)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 483671Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 483961Protein UMP/CMP kinase [52550] (2 species)
  7. 483962Species Dictyostelium discoideum [TaxId:44689] [52551] (6 PDB entries)
  8. 483964Domain d3ukd__: 3ukd - [31849]

Details for d3ukd__

PDB Entry: 3ukd (more details), 1.9 Å

PDB Description: ump/cmp kinase from slime mold complexed with adp, cmp, and alf3

SCOP Domain Sequences for d3ukd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ukd__ c.37.1.1 (-) UMP/CMP kinase {Dictyostelium discoideum}
skpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmiknge
ivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpeev
mtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnevyn
dvenlfksmgf

SCOP Domain Coordinates for d3ukd__:

Click to download the PDB-style file with coordinates for d3ukd__.
(The format of our PDB-style files is described here.)

Timeline for d3ukd__: