Lineage for d5f1xb2 (5f1x B:214-407)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138577Species Human (Homo sapiens) [TaxId:9606] [224896] (58 PDB entries)
  8. 2138676Domain d5f1xb2: 5f1x B:214-407 [318463]
    automated match to d3iucc2
    complexed with atp

Details for d5f1xb2

PDB Entry: 5f1x (more details), 1.9 Å

PDB Description: crystal structure of human grp78 (70kda heat shock protein 5 / bip) atpase domain in complex with atp
PDB Compounds: (B:) 78 kDa glucose-regulated protein

SCOPe Domain Sequences for d5f1xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f1xb2 c.55.1.0 (B:214-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
regeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkk
tgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakfeelnmd
lfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdea
vaygaavqagvlsg

SCOPe Domain Coordinates for d5f1xb2:

Click to download the PDB-style file with coordinates for d5f1xb2.
(The format of our PDB-style files is described here.)

Timeline for d5f1xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f1xb1