Lineage for d2pdab1 (2pda B:2-258)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1592897Family c.36.1.8: PFOR Pyr module [88746] (1 protein)
    domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
    automatically mapped to Pfam PF01855
  6. 1592898Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain I [88747] (1 species)
  7. 1592899Species Desulfovibrio africanus [TaxId:873] [88748] (10 PDB entries)
  8. 1592919Domain d2pdab1: 2pda B:2-258 [31837]
    Other proteins in same PDB: d2pdaa2, d2pdaa3, d2pdaa4, d2pdaa5, d2pdab2, d2pdab3, d2pdab4, d2pdab5
    complexed with ca, mg, pyr, sf4, tpp

Details for d2pdab1

PDB Entry: 2pda (more details), 3 Å

PDB Description: crystal structure of the complex between pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus and pyruvate.
PDB Compounds: (B:) protein (pyruvate-ferredoxin oxidoreductase)

SCOPe Domain Sequences for d2pdab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdab1 c.36.1.8 (B:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

SCOPe Domain Coordinates for d2pdab1:

Click to download the PDB-style file with coordinates for d2pdab1.
(The format of our PDB-style files is described here.)

Timeline for d2pdab1: