Lineage for d1ay0b1 (1ay0 B:3-337)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986456Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 986457Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 986874Family c.36.1.10: TK-like PP module [88760] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 986893Protein Transketolase (TK), PP module [88761] (4 species)
  7. 986894Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88762] (7 PDB entries)
  8. 986908Domain d1ay0b1: 1ay0 B:3-337 [31825]
    Other proteins in same PDB: d1ay0a2, d1ay0a3, d1ay0b2, d1ay0b3
    complexed with ca, tpp

Details for d1ay0b1

PDB Entry: 1ay0 (more details), 2.6 Å

PDB Description: identification of catalytically important residues in yeast transketolase
PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d1ay0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ay0b1 c.36.1.10 (B:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
likmtttigygslhagshsvagaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
kpgveannkwnklfseyqkkfpelgaelarrlsgq

SCOPe Domain Coordinates for d1ay0b1:

Click to download the PDB-style file with coordinates for d1ay0b1.
(The format of our PDB-style files is described here.)

Timeline for d1ay0b1: