Lineage for d4zhtc_ (4zht C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518443Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2518444Protein automated matches [190965] (39 species)
    not a true protein
  7. 2518524Species Human (Homo sapiens) [TaxId:9606] [318032] (1 PDB entry)
  8. 2518527Domain d4zhtc_: 4zht C: [318034]
    automated match to d1f6dd_
    complexed with bm7, ncc, udp

Details for d4zhtc_

PDB Entry: 4zht (more details), 2.69 Å

PDB Description: crystal structure of udp-glcnac 2-epimerase
PDB Compounds: (C:) Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase

SCOPe Domain Sequences for d4zhtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zhtc_ c.87.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nnrklrvcvatcnradysklapimfgiktepeffeldvvvlgshliddygntyrmieqdd
fdintrlhtivrgedeaamvesvglalvklpdvlnrlkpdimivhgdrfdalalatsaal
mnirilhieggevsgtiddsirhaitklahyhvcctrsaeqhlismcedhdrillagcps
ydkllsaknkdymsiirmwlgddvkskdyivalqhpvttdikhsikmfeltldalisfnk
rtlvlfpnidagskemvrvmrkkgiehhpnfravkhvpfdqfiqlvahagcmignsscgv
revgafgtpvinlgtrqigretgenvlhvrdadtqdkilqalhlqfgkqypcskiygdgn
avprilkflksidlqeplqkkfc

SCOPe Domain Coordinates for d4zhtc_:

Click to download the PDB-style file with coordinates for d4zhtc_.
(The format of our PDB-style files is described here.)

Timeline for d4zhtc_: