Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) |
Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
Protein automated matches [190965] (39 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [318032] (1 PDB entry) |
Domain d4zhtc_: 4zht C: [318034] automated match to d1f6dd_ complexed with bm7, ncc, udp |
PDB Entry: 4zht (more details), 2.69 Å
SCOPe Domain Sequences for d4zhtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zhtc_ c.87.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nnrklrvcvatcnradysklapimfgiktepeffeldvvvlgshliddygntyrmieqdd fdintrlhtivrgedeaamvesvglalvklpdvlnrlkpdimivhgdrfdalalatsaal mnirilhieggevsgtiddsirhaitklahyhvcctrsaeqhlismcedhdrillagcps ydkllsaknkdymsiirmwlgddvkskdyivalqhpvttdikhsikmfeltldalisfnk rtlvlfpnidagskemvrvmrkkgiehhpnfravkhvpfdqfiqlvahagcmignsscgv revgafgtpvinlgtrqigretgenvlhvrdadtqdkilqalhlqfgkqypcskiygdgn avprilkflksidlqeplqkkfc
Timeline for d4zhtc_: