Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology |
Protein Pyruvate oxidase [88729] (2 species) |
Species Lactobacillus plantarum [TaxId:1590] [88730] (7 PDB entries) |
Domain d1poxa2: 1pox A:9-182 [31793] Other proteins in same PDB: d1poxa1, d1poxa3, d1poxb1, d1poxb3 complexed with fad, gol, mg, na, tpp; mutant |
PDB Entry: 1pox (more details), 2.1 Å
SCOPe Domain Sequences for d1poxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1poxa2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqisaedw
Timeline for d1poxa2: