Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (12 species) not a true protein |
Species Serratia marcescens [TaxId:615] [186800] (10 PDB entries) |
Domain d5ev8c_: 5ev8 C: [317929] automated match to d1jjeb_ complexed with 3r9, cl, dms, edo, na, zn |
PDB Entry: 5ev8 (more details), 2.3 Å
SCOPe Domain Sequences for d5ev8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ev8c_ d.157.1.1 (C:) automated matches {Serratia marcescens [TaxId: 615]} slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl lkskygkaklvvpshsevgdasllkltleqavkglneskkpsk
Timeline for d5ev8c_: