Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (12 species) not a true protein |
Species Stenotrophomonas maltophilia [TaxId:40324] [186946] (10 PDB entries) |
Domain d5evka_: 5evk A: [317922] automated match to d2fu9a_ complexed with 3c7, so4, zn |
PDB Entry: 5evk (more details), 1.63 Å
SCOPe Domain Sequences for d5evka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5evka_ d.157.1.1 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 40324]} evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga kaltckayadaaeqkfdgqlaketag
Timeline for d5evka_: