Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (9 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [189958] (6 PDB entries) |
Domain d5c90e_: 5c90 E: [317794] automated match to d3qwda_ complexed with mpd; mutant |
PDB Entry: 5c90 (more details), 1.75 Å
SCOPe Domain Sequences for d5c90e_:
Sequence, based on SEQRES records: (download)
>d5c90e_ c.14.1.1 (E:) automated matches {Staphylococcus aureus [TaxId: 93061]} liptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyl ainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmi hqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeake yglidevmvpet
>d5c90e_ c.14.1.1 (E:) automated matches {Staphylococcus aureus [TaxId: 93061]} liptvieraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspg gsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplgg aqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglide vmvpet
Timeline for d5c90e_: