SCOPe 2.07: Domain d5g1ka1: 5g1k A:3-61

Lineage for d5g1ka1 (5g1k A:3-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families)

5. Family d.17.3.0: automated matches [228319] (1 protein)
   not a true family

6. Protein automated matches [228320] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [317729] (2 PDB entries)

8. Domain d5g1ka1: 5g1k A:3-61 [317744]
   Other proteins in same PDB: d5g1ka2, d5g1kb2
   automated match to d1v58a2
   complexed with so4; mutant

Details for d5g1ka1

PDB Entry: 5g1k, 1.96 Å

PDB Description: a triple mutant of dsbg engineered for denitrosylation

PDB Compounds: (A:) thiol disulfide interchange protein dsbg

SCOPe Domain Sequences for d5g1ka1:

Sequence; same for both SEQRES and ATOM records:

>d5g1ka1 d.17.3.0 (A:3-61) automated matches {Escherichia coli [TaxId: 562]}
lpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge

Timeline for d5g1ka1:

• d5g1ka1 first appeared in SCOPe 2.06
  
• d5g1ka1 appears in the current release, SCOPe 2.08