SCOPe 2.07: Domain d5g1lb2: 5g1l B:62-230

Lineage for d5g1lb2 (5g1l B:62-230)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
   elaborated common fold

6. Protein automated matches [228323] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [317731] (2 PDB entries)

8. Domain d5g1lb2: 5g1l B:62-230 [317732]
   Other proteins in same PDB: d5g1la1, d5g1lb1
   automated match to d1v58a1
   complexed with so4; mutant

Details for d5g1lb2

PDB Entry: 5g1l, 1.7 Å

PDB Description: a double mutant of dsbg engineered for denitrosylation

PDB Compounds: (B:) thiol disulfide interchange protein dsbg

SCOPe Domain Sequences for d5g1lb2:

Sequence; same for both SEQRES and ATOM records:

>d5g1lb2 c.47.1.9 (B:62-230) automated matches {Escherichia coli [TaxId: 562]}
nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcgpckqfwqqarp
wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
mkvlsdneklmddlganvtpaiyymskentlqqavglpdqktlniimgn

Timeline for d5g1lb2:

• d5g1lb2 first appeared in SCOPe 2.06
  
• d5g1lb2 appears in the current release, SCOPe 2.08