Lineage for d1nbaa_ (1nba A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445599Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445600Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2445601Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)
  6. 2445608Protein N-carbamoylsarcosine amidohydrolase [52501] (1 species)
  7. 2445609Species Arthrobacter sp. [TaxId:1667] [52502] (1 PDB entry)
  8. 2445610Domain d1nbaa_: 1nba A: [31753]
    complexed with so4

Details for d1nbaa_

PDB Entry: 1nba (more details), 2 Å

PDB Description: crystal structure analysis, refinement and enzymatic reaction mechanism of n-carbamoylsarcosine amidohydrolase from arthrobacter sp. at 2.0 angstroms resolution
PDB Compounds: (A:) n-carbamoylsarcosine amidohydrolase

SCOPe Domain Sequences for d1nbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbaa_ c.33.1.3 (A:) N-carbamoylsarcosine amidohydrolase {Arthrobacter sp. [TaxId: 1667]}
tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
dpqpeveapadpv

SCOPe Domain Coordinates for d1nbaa_:

Click to download the PDB-style file with coordinates for d1nbaa_.
(The format of our PDB-style files is described here.)

Timeline for d1nbaa_: