PDB entry 1nba

View 1nba on RCSB PDB site
Description: crystal structure analysis, refinement and enzymatic reaction mechanism of n-carbamoylsarcosine amidohydrolase from arthrobacter sp. at 2.0 angstroms resolution
Class: hydrolase(in linear amides)
Keywords: hydrolase(in linear amides)
Deposited on 1992-05-18, released 1994-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-carbamoylsarcosine amidohydrolase
    Species: Arthrobacter sp. [TaxId:1667]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nbaa_
  • Chain 'B':
    Compound: n-carbamoylsarcosine amidohydrolase
    Species: Arthrobacter sp. [TaxId:1667]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nbab_
  • Chain 'C':
    Compound: n-carbamoylsarcosine amidohydrolase
    Species: Arthrobacter sp. [TaxId:1667]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nbac_
  • Chain 'D':
    Compound: n-carbamoylsarcosine amidohydrolase
    Species: Arthrobacter sp. [TaxId:1667]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nbad_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nbaA (A:)
    mtetsgtfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpg
    hpfscpgmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetl
    padsywaqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrh
    tvedaiakgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedt
    vpktlsdpqpeveapadpvfaeqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbaA (A:)
    tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
    gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
    aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
    akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
    dpqpeveapadpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nbaB (B:)
    mtetsgtfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpg
    hpfscpgmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetl
    padsywaqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrh
    tvedaiakgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedt
    vpktlsdpqpeveapadpvfaeqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbaB (B:)
    fndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscpg
    metiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsywa
    qiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedaia
    kgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktlsd
    pqpeveapadpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nbaC (C:)
    mtetsgtfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpg
    hpfscpgmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetl
    padsywaqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrh
    tvedaiakgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedt
    vpktlsdpqpeveapadpvfaeqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbaC (C:)
    tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
    gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
    aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
    akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
    dpqpeveapadpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nbaD (D:)
    mtetsgtfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpg
    hpfscpgmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetl
    padsywaqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrh
    tvedaiakgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedt
    vpktlsdpqpeveapadpvfaeqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbaD (D:)
    tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
    gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
    aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
    akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
    dpqpeveapadpv